PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G14780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24593.1 Da    PI: 9.0978
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G14780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.82.5e-27959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtfskRr+gilKKA E+ vLCdaev v+ifss gkl +y++
  OMERI05G14780.1  9 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCT 59
                     79***********************************************96 PP

2K-box59.41.5e-2071169197
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqR..hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                      yq++sgk l+++k++sl+ e++++kke++n+q e+R  h++GedL+sL+ keL  +e++L+++  + R+k +++++++ ++ ++ e+e++    
  OMERI05G14780.1  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRlvHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDEHKMLAF 164
                      89999999************************998888********************************998888888888888888777766 PP

            K-box  93 aLrkk 97 
                      + +++
  OMERI05G14780.1 165 RVHQQ 169
                      66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002657.33E-41280No hitNo description
SuperFamilySSF554553.27E-32295IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-1382166IPR002487Transcription factor, K-box
PROSITE profilePS5129711.78884172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGILK KAREIGVLCD AEVGVVIFSS AGKLSDYCTP  60
KTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLVHM KGEDLNSLQP  120
KELIAIEEAL NNGQANLRDK MMDHWRMHKR NEKMLEDEHK MLAFRVHQQE VELSGGIREL  180
ELGYHHDDRD FAASMPFTFR VQPSHPNLQQ EK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18171169Myocyte-specific enhancer factor 2B
1tqe_Q2e-18171169Myocyte-specific enhancer factor 2B
1tqe_R2e-18171169Myocyte-specific enhancer factor 2B
1tqe_S2e-18171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankRICOSMAA0.0L37527.1 Oryza sativa MADS box protein (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640709.11e-155PREDICTED: MADS-box transcription factor 4 isoform X1
SwissprotQ407031e-154MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A0D3G7T81e-158A0A0D3G7T8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0DRK41e-158A0A0E0DRK4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0PMQ21e-157A0A0E0PMQ2_ORYRU; Uncharacterized protein
STRINGBGIOSGA019900-PA1e-154(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.14e-72MIKC_MADS family protein